Skip to main content

Table 3 Protein identification of Blattella germanica

From: Identification of the main allergen sensitizers in an Iran asthmatic population by molecular diagnosis

  SDS-PAGE protein 1 SDS-PAGE protein 2
Calculated MW 53 kDa 42 kDa
Theorical MW 57.501 kDa 40.109 kDa
Protein description Alpha amylase Arginine kinase
Peptide sequence matched r.saivhlfewkfadiadecerf.l k.laasdsksllr.k
k.gfagvqvspvhenviisspfrpwwer.y k.hppkdwgdvdtlgnldpageyiistrvrcgrsmqgypfnpclteaqyk.e
v.rncelvglhdlnqgsdyvr.g k.gqfypltgmtk.e
k.vnnlntdhgfpsgarpffyqevidlggeaihsteytgfgr.v r.flqhanacr.f
k.mavafmlaypygyp.r k.tflvwcneedhlriismqmggdlgqvyrrlvtavndiekrvpfshddrlgf.l
r.qifnmvgfrnavagtavsnwwdngdkqisfcr.g  
k.gfvafndefnndlk.q
Sequence covered 36.31% 43.5%
Mascot score 200 292
Mascot expect 3.3E-014 2.1E-023
NCBI accession number gi|85002763 gi|86160922
  1. Results of Mascot search.